IGF1-LR3 Liquid Peptide (Insulin-like growth factor 1 long arginine 3) 1mg

Product Name
IGF1-LR3 Liquid Peptide (Insulin-like growth factor 1 long arginine 3) 1mg
In stock
SKU
19
£49.00

Also known as Insulin Growth Factor 1 Long R3 IGF-1 LR3 is a single chain of polypeptides which consists of 83 amino acids. The growth factor IGF1 has many other effects which helps promoting growth and development in growth hormone(GH;MIM 139250). There is a long term analog of IGF-1 human growth factor i-e LR3, which is responsible for support of recombinant bio-pharmaceuticals manufacture at large. Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms:Long R3 IGF-1, IGF-1 LR3 (Long R3 IGF-1), LR3 IGF, IGF1 LR3, Long Arg3 IGF-1


This product is a lyophilized peptide for research use only. This product is NOT for human use and can be harmful if ingested. This product is for research/laboratory use only. This product is NOT to be injected. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and should not be misbranded, misused or mislabeled as a drug, food or cosmetic.